PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa016373
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 329aa    MW: 36042.9 Da    PI: 8.566
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-512PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.8e-2460102244
        WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                 epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Lsa016373  60 LEPGRCKRTDGKKWRCSRDVAPNQKYCERHMHRGRPRSRKHVE 102
                69***************************************97 PP

2QLQ57.54.1e-20841235
        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35
               +FTaaQ+++L++Q+++yKy++a++P+P eLl++i
  Lsa016373  8 PFTAAQWMELERQAMIYKYMVASVPIPYELLLPI 41
               8*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-13743IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.074843IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.7E-15841IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.31259103IPR014977WRC domain
PfamPF088794.1E-2061102IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAATLGFPFT AAQWMELERQ AMIYKYMVAS VPIPYELLLP IIQNLPSLAS QLKYSTKQDL  60
EPGRCKRTDG KKWRCSRDVA PNQKYCERHM HRGRPRSRKH VELFKNPTTN NSRIRLPNPT  120
SQLSTHSNHC RVLGSTILPS ATEAPLFLDS NMHSKTVNNR GLDWSLDVEY EQQWRQIMQT  180
SCSIFNSDFG NFTDFGTPRR DFITDKTSVV KDSSTLDLSM AMGLGLGLGK HERDLGLVSP  240
VSCGTAPGGP PAEVLIPGPS SVAVGSNPTS PYPTGSDSIS VSPAATTVSS PCGVLQSQRT  300
MLSLSDGSVC NSPTLASTPT DIVAFQWFT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084563.13e-67PREDICTED: growth-regulating factor 7-like isoform X3
TrEMBLA0A103XBI91e-131A0A103XBI9_CYNCS; Glutamine-Leucine-Glutamine, QLQ
STRINGPGSC0003DMT4000083524e-66(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-39growth-regulating factor 7